Übersicht / WARENWIRTSCHAFTSSYSTEME / Deutschland
Firmen & Branchen Links & Kontakte



Suche in: Branchen (richtungen) Firmen » Leistungen » Angebote » Ort
Anbieter • Firmen • Unternehmen • Händler • Betriebe • Onlineshop • Angebote • Verkauf
Bei uns können Sie kostenlos Ihre URL anmelden oder kostenlos Ihren Link eintragen!


Redaktionslink für: "WARENWIRTSCHAFTSSYSTEME"
  • Pole Position für Ihr Unternehmen?
  • Einen Link zu Ihrer Homepage hier?
  • Senden Sie Ihre Anfrage an werbung (at-zeichen) branchen-domain.de
Sponsoren-Links & Redaktionslink zu: "WARENWIRTSCHAFTSSYSTEME" werden von uns auf Themen - Relevanz überprüft! * Sie wollen mehr Besucher auf Ihrer Homepage? Schalten Sie eine Werbung auf unseren Seiten: "WARENWIRTSCHAFTSSYSTEME" * Dieser Service is Powered by Branchen Domain de



[ 1 ] 2 3 4 5 6 7 

Firma: ERP4all Business Software GmbH - Ort: Willich - Plz: 47877 - Strasse: Jakob-Kaiser-Strasse 7 - Branche(n): Betriebsdatenerfassungssysteme, Betriebsorganisation, Branchensoftware, Finanzbuchhaltung, Softwareentwicklung, Warenwirtschaftssysteme, Zeiterfassungssysteme, - Leistungen:Betriebswirtschaftliche Standard ERP/PPS Software für kleine und mittelständische Unternehmen aus Handel, Dienstleistung und Fertigung, mit den Bereichen - Produktionsplanung PPS - Auftragsbearbeitung - Warenwirtschaft - Enterprise Ressource Planning ERP - CAQ - Betriebsdatenerfassung BDE - Finanzbuchhaltung - Lohn/Gehalt - Personalzeiterfassung PZE - Customer Relationship Management CRM - Materialwirtschaft/Disposition - Vertriebssteuerung - Einkauf - Fertigungssteuerung - Lagerwesen, ERP4all Business Software GmbH Homepage Mail schreiben!
Jakob-Kaiser-Strasse 7
Willich 47877
Tel.: 02154 8133 0
Fax:02154 8133 25
Leistungen - Angebote
Betriebswirtschaftliche Standard ERP/PPS Software für kleine und mittelständische Unternehmen aus Handel, Dienstleistung und Fertigung, mit den Bereichen - Produktionsplanung PPS - Auftragsbearbeitung - Warenwirtschaft - Enterprise Ressource Planning..
Unternehmens - Portrait
..BETRIEBSDATENERFASSUNGSSYSTEME, BETRIEBSORGANISATION, BRANCHENSOFTWARE, FINANZBUCHHALTUNG, SOFTWAREENTWICKLUNG, WARENWIRTSCHAFTSSYSTEME, ZEITERFASSUNGSSYSTEME..mehr..
Firma: Rattay Datentechnik - Ort: Lauterstein - Plz: 73111 - Strasse: Galgenbergstraße 16 - Branche(n): EDV-Beratung, EDV-Schulung, Internetshops, Warenwirtschaftssysteme, Webdesign, - Leistungen:Computer, Hardware, Internet, Netzwerk, PC, Schulungen, Software, Warenwirtschaft, Webdesign, Rattay Datentechnik Homepage Mail schreiben!
Galgenbergstraße 16
Lauterstein 73111
Tel.: 07332 924991
Fax:07332 968475
Leistungen - Angebote
Computer, Hardware, Internet, Netzwerk, PC, Schulungen, Software, Warenwirtschaft, Webdesign,
Unternehmens - Portrait
..EDV-BERATUNG, EDV-SCHULUNG, INTERNETSHOPS, WARENWIRTSCHAFTSSYSTEME, WEBDESIGN..mehr..
Firma: DSHG Deutsche Software systemHaus AG - Ort: Berlin - Plz: 12163 - Strasse: Schloßstr. 107 - Branche(n): Softwareentwicklung, Suchmaschinenoptimierung, Warenwirtschaftssysteme, - Leistungen:Berlin, CMS, DMS, DOSM, DSHG, Delphi, Deutsche Software systemHaus AG, Dienstleistungen, ERP, Entwicklung, Flash, HoBuSy, Offline, Optimierung, PHP, Programmierung, Ranking, Shopmanager, Suchmaschinen, Typo3, Warenwirtschaft, Webentwicklung, kaperto, DSHG Deutsche Software systemHaus AG Homepage Mail schreiben!
Schloßstr. 107
Berlin 12163
Tel.: 030 79 01 83 0
Fax:030 79018329
Leistungen - Angebote
Berlin, CMS, DMS, DOSM, DSHG, Delphi, Deutsche Software systemHaus AG, Dienstleistungen, ERP, Entwicklung, Flash, HoBuSy, Offline, Optimierung, PHP, Programmierung, Ranking, Shopmanager, Suchmaschinen, Typo3, Warenwirtschaft, Webentwicklung, kaperto,
Unternehmens - Portrait
..SOFTWAREENTWICKLUNG, SUCHMASCHINENOPTIMIERUNG, WARENWIRTSCHAFTSSYSTEME..mehr..
Firma: kaperto - ERP, Warenwirtschaftssystem, Unternehmenslösung für den Einzelhandel aus Berlin - Ort: Berlin - Plz: 12163 - Strasse: Schloßstr. 107 - Branche(n): Controlling, Software, Warenwirtschaftssysteme, - Leistungen:Auswertungen, Berlin, Buchhaltung, CRS, Chain, Controlling, Datenreplikation, Deutsche Software systemHaus AG, Durchlaufzeit, Durchlaufzeiten, ERP, Einkauf, Einzelhandel, Kundendienst, Kundenverwaltung, Lager, Lagermanagement, Logistik, Mittelstand, Personal, Stammdaten, Supply, Supply Chain, Unternehmenslösung, Warenwirtschaft, Warenwirtschaftssystem, WebShop, kaperto, kaperto - ERP, Warenwirtschaftssystem, Unternehmenslösung für den Einzelhandel aus Berlin Mail schreiben!
Schloßstr. 107
Berlin 12163
Tel.: 030 79 01 83 0
Fax:030 79018329
Leistungen - Angebote
Auswertungen, Berlin, Buchhaltung, CRS, Chain, Controlling, Datenreplikation, Deutsche Software systemHaus AG, Durchlaufzeit, Durchlaufzeiten, ERP, Einkauf, Einzelhandel, Kundendienst, Kundenverwaltung, Lager, Lagermanagement, Logistik, Mittelstand, ..
Unternehmens - Portrait
..CONTROLLING, SOFTWARE, WARENWIRTSCHAFTSSYSTEME..mehr..
Firma: 3S GmbH - Ort: Attendorn - Plz: 57439 - Strasse: Enzianstr. 6-8 - Branche(n): Warenwirtschaftssysteme, - Leistungen:3S ERP / PPS Software für kleine und mittelständische Unternehmen., 3S GmbH Homepage Mail schreiben!
Enzianstr. 6-8
Attendorn 57439
Tel.: 0 27 22 92 90 90
Fax:0 27 22 92 90 99
Leistungen - Angebote
3S ERP / PPS Software für kleine und mittelständische Unternehmen.,
Unternehmens - Portrait
..WARENWIRTSCHAFTSSYSTEME..mehr..

[ 1 ] 2 3 4 5 6 7 


Insgesamt [1] Treffer aus dem Open Directory Project vorhanden.

Suchergebnis:
[1] Warenwirtschaftssysteme |

Die OPD - Datenbank wurde durchsucht nach 'WARENWIRTSCHAFTSSYSTEME'.
Durchsuchte Rubrik(en) Anzahl (1)

Warenwirtschaftssysteme (1) »

Jetzt eintragen für: WARENWIRTSCHAFTSSYSTEME !

Kostenloser Eintrags Service
Unser Eintragsvorschlag "Bitte wählen Sie Ihre Eintragsrubrik aus!"
x Warenwirtschaftssysteme   Keine Rubrik gefunden? Dann >>hier!<<

Suchagent und Assoziator (Link öffnet Popup)Der Suchagent (Assoziator) hilft Ihnen bei der Auswahl der Leistungsbeschreibung und den Suchworten für Ihren kostenlosen Eintrag!
Assoziationen zur Branchenrichtung: Warenwirtschaftssysteme

warenwirtschaftssystemwarenwirtschaftssystem handelwarenwirtschaftssystem einzelhandelkonzept modulares warenwirtschaftssystem
warenwirtschaftssystem grosshandelmodulares warenwirtschaftssystemgastronomie warenwirtschaftssystemwarenwirtschaftssystem kostenlos
warenwirtschaftssystem grosshandel luebeckwarenwirtschaftssystem schuhkostenlos warenwirtschaftssystemwarenwirtschaftssystem luebeck
datenbankgestuetzte warenwirtschaftssystem internetdefinition warenwirtschaftssystemlogistik bwl warenwirtschaftssystemlogistik wissen warenwirtschaftssystem
warenwirtschaftssystem freewarewarenwirtschaftssystem paketscheinwarenwirtschaftssystem sapgewa ges f warenwirtschaftssystem
guenstiges warenwirtschaftssystemwarenwirtschaftssystem autohauswarenwirtschaftssystem bekleidung


Suchzeit: 0.111 Sekunden


A B C D E F G H I J K L M N O P Q R S T U V W Y Z Ä Ü Ö
Autos, Motorräder & Verkehr Computer & Technik Finanzen & Wirtschaft Freizeit, Lifestyle & Wellness Immobilien & Wohnen Kommunikation Kunst & Kultur Reisen & Tourismus Spiele & Online Games Sport & Fitness Unterhaltung & Hobby Webmaster


Alle Rechte vorbehalten für Gestaltung und Programmierung.
All rights reserved for design and programming.
Copyright brainbyte internet

This site is HTML 4.01 compatible. This site is made with Cascading Style Sheets.